GVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLGLLILILLLLLLALLSPDMLGĭPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVILGLMPFLHT GQMSFWGATVITNLFSAIPYIGTNLVEWIWGGFSVDKATLNRFFAFHFILPFTMVALA translation="LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPW National d'Histoire Naturelle, 43 rue Cuvier, Paris 75005, France JOURNAL Submitted (0) Service de Systematique Moleculaire, Museum TITLE Molecular phylogeny of Elephantidae. Mammalia Eutheria Afrotheria Proboscidea Elephantidae Elephas.ĪUTHORS Barriel,V., Thuet,E. SOURCE mitochondrion Elephas maximus maximusĮukaryota Metazoa Chordata Craniata Vertebrata Euteleostomi Mitochondrial gene for mitochondrial product. Nucleotide example: AF132523 LOCUS AF132523 853 bp DNA linear MAM 2ĭEFINITION Elephas maximus maximus cytochrome b gene, partial cds We will discuss this in upcoming sessions. Soft mask: Letters are converted to lowercaseĭerived extended format used in sequencing projects: FASTQ.Hard mask: Letters are converted to “X”.So, it is advisable to use uppercase by default. However, it is quite widespread that some programs (such as RepeatMasker) convert to lowercase some low complexity sequence regions (e.g. In principle it does not matter whether letters are uppercase or lowercase. In most cases files can even be uncompressed and opened straight from the browser. gz ( Gzip) is, by far, the most common compression approach and, in many cases, it is recognized by many software applications. You can notice it with the following extensions. TRIVIA: File format or type is not the same as file extension, despite the later should help to identify the former.įiles can also be compressed for helping distribution and saving space.įASTA, as text files, they can be highly compressed. LGLMPLLHTSKHRSMMLRPLSQVLFWTLTMDLLTLTWIGSQPVEHPYIIIGQMASILYFSĭespite FASTA is a text file format in the end, some file extension prefixes are used as a convention for helping to identify file content among many different files. LLALLSPDMLGDPDNYMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSILI LITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLVEWIWGGFSVDKATLNRFFAįHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLGLLILILLLL TAFSSMSHICRDVNYGWIIRQLHSNGASIFFLCLYTHIGRNIYYGSYLYSETWNTGIMLL MTHTRKFHPLFKIINKSFIDLPTPSNISTWWNFGSLLGACLITQILTGLFLAMHYTPDTM GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGXĮxample with Name and Description in Header >MySequence My description of a proteinĮxample with Accessions or Identifiers, description and organism in Header >gi|5524211|gb|AAD44166.1| cytochrome b Įxample with Accessions or Identifiers, description and organism in Header ( NCBI FASTA format) >AAD44166.1 cytochrome b, partial (mitochondrion) Įxample with Accessions or Identifiers, description and organism in Header ( UniProt Fasta Headers) >sp|O47885|CYB_ELEMA Cytochrome b OS=Elephas maximus OX=9783 GN=MT-CYB PE=3 SV=1 LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLVĮWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG Sequence - 2nd, 3rd and following lines.Reference: Wikipedia article Nucleic acids Nucleic Acid Code Introduction and Importance of Bioinformatics.La naturalesa computacional de la vida (Computational nature of life, Roderic’s Guigó presentation -in Catalan-).Human Genome Project - First Draft (1990-2003).Needleman-Wunsch (1970) - Sequence alignment algorithm.(1965) - Atlas of protein sequence and structure Pauling (1964) - Molecules as documents of evolutionary history Crick (1958) - Central dogma of molecular biology.Watson & Crick (1953) - Comment about permutation and genetic information.Alexander Dounce (1952) - Comment about transcription and translation.Schrodinger, What is life? (1944) - Mention to code-script of organism.Similar or related terms: computational biology, systems biology, etc. Bioinformatics: interdisciplinary field that develops methods and software tools for understanding biological data.
0 Comments
Leave a Reply. |
Details
AuthorWrite something about yourself. No need to be fancy, just an overview. ArchivesCategories |